IL-33 Protein, Pig, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 44.6 kDa and the accession number is M5B263.

Sus scrofa (Pig)

E. coli

Interleukin-33,IL-33

EHSASLSTYNDQYITFAFEDGSYEIYVEDLRKDQEKDKVLLRYYDSQIPSSETDGGGDHRKLMVNLSPTKDKDFLLHANSKEHSVELQKCENPLPEQAFFVLHEQPSKCVSFECKSHPGVFLGVKNNQLALIKLGEHPEDSNRENTTFKLSNLM

123-276 aa

> 90% as determined by SDS-PAGE.

A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

N/A