Uteroglobin Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is Q06318.

Mouse

E. coli

Utg,Uteroglobin,Ugb,Secretoglobin family 1A member 1,Scgb1a1,PCB-binding protein,Club cells 10 kDa secretory protein (CC10),Club cell phospholipid-binding protein (CCPBP),Club cell 17 kDa protein,Cc10

DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF

22-96 aa

>98% as determined by SDS-PAGE.

Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.