Involved in disease resistance. SAM22 Protein, Glycine max, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.8 kDa and the accession number is P26987.

Glycine max

P. pastoris (Yeast)

Stress-induced protein SAM22,Starvation-associated message 22,PR-10,Pathogenesis-related protein 10

MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALDSFKSVENVEGNGGPGTIKKITFLEDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVKYETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPDYN

1-158 aa

> 90% as determined by SDS-PAGE.

A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Involved in disease resistance.