Part of an ATP-driven transport system. PsaA Protein, S. oralis, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 40.1 kDa and the accession number is Q9L5W9.

Streptococcus oralis

E. coli

psaA,Pneumococcal surface adhesin A,Manganese ABC transporter substrate-binding lipoprotein PsaA

CASGKKDATSGQKLKVVATNSIIADITKNIAGDKIDLHSIVPVGQDPHEYEPLPEDVKKTSEADLIFYNGINLETGGNAWFTKLVENAKKTENKDYFAVSEGVDVIYLEGQNEKGKEDPHAWLNLENGMIYAKNIAKQLIAKDPSNKEFYEKNLKDYTEKLDKLDKEAKEKFNNIPAEKKLIVTSEGCFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVSQDTNIPIYAQIFTDSIAEEGKEGDSYYSMMKYNLDKIAEGLSK

20-309 aa

> 90% as determined by SDS-PAGE.

Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Part of an ATP-driven transport system.