Human coronavirus HKU1 (isolate N5) Non-structural protein 4 (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 18.5 kDa and the accession number is Q0ZME6.

HCoV-HKU1

E. coli

Orf4 protein,Non-structural protein of 12.5 kDa,Non-structural protein 4,Accessory protein 4

MEVWRPSYKYSLITREFGVTDLEDLCFKYNYCQPCVGYCIVPLNVWCRKFGKFASYFVLRSHDTSHKNNFGVITSFTSYGNTVSEAVSKLVESASDFIAWRAEALNKYG

1-109 aa

> 85% as determined by SDS-PAGE.

Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

N/A