Glycoprotein hormones alpha chain Protein, Canine, Recombinant (His & Myc) is expressed in E. coli.

Canine

E. coli

Thyrotropin alpha chain,Thyroid-stimulating hormone alpha chain,Lutropin alpha chain,Luteinizing hormone alpha chain,Glycoprotein hormones alpha chain,Follitropin alpha chain,Follicle-stimulating hormone alpha chain,CGA,Anterior pituitary glycoprotein hormones common subunit alpha

FPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS

25-120 aa

> 90% as determined by SDS-PAGE.

Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways.