Beta-mammal/insect toxin Ts1 Protein, Tityus serrulatus, Recombinant (E. coli, His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 14.3 kDa and the accession number is P15226.

Tityus serrulatus

E. coli

Ts7,Ts VII,Toxin VII,Toxin III-10,Toxin II-11,Tityustoxin VII,PT-Mice-Ins-beta NaTx6.1,Beta-mammal/insect toxin Ts1,Beta-like toxin Ts1

KEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKC

21-81 aa

> 85% as determined by SDS-PAGE.

A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Voltage-gated sodium channels (Nav) gating-modifier. Acts both as alpha- and beta-toxin, since it affects not only activation but also inactivation of Nav channels (Probable). Binds to Nav domain DII and impairs the four Nav channel voltage sensors movements. Depending on Nav channel subtypes tested, can also bind Nav domains DIII (low affinity) and DIV (very low affinity). Acts on almost all the Nav channels tested (mammalian Nav1.2/SCN2A, Nav1.3/SCN3A, Nav1.4/SCN4A, Nav1.5/SCN5A, Nav1.6/SCN8A, Nav1.9/SCN11A, and insect DmNav1). Is highly active against both mammals and insects. Irreversibly modulates DmNav channels. Other Ts1 activities have been studied, such as immunomodulation, antimicrobial activity or exocrine secretion (Probable). This toxin exhibits an antifungal activity against filamentous fungi. In vitro, it has an important immunomodulatory effect on macrophages by stimulating the release of proinflammatory cytokines. It also shows an activity in exocrine secretion in pancreas, stomach and adrenal gland.